SCOPe 2.08: Domain d4jrmc1: 4jrm C:2-252

Lineage for d4jrmc1 (4jrm C:2-252)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.0: automated matches [196908] (1 protein)
   not a true family

6. Protein automated matches [196909] (83 species)
   not a true protein

7. Species Vibrio cholerae [TaxId:243277] [226630] (3 PDB entries)

8. Domain d4jrmc1: 4jrm C:2-252 [223965]
   automated match to d2alma1
   complexed with act, gol

Details for d4jrmc1

PDB Entry: 4jrm, 1.75 Å

PDB Description: crystal structure of beta-ketoacyl-acp synthase ii (fabf) from vibrio cholerae (space group p212121) at 1.75 angstrom

PDB Compounds: (C:) 3-oxoacyl-[acyl-carrier-protein] synthase 2

SCOPe Domain Sequences for d4jrmc1:

Sequence; same for both SEQRES and ATOM records:

>d4jrmc1 c.95.1.0 (C:2-252) automated matches {Vibrio cholerae [TaxId: 243277]}
skrrvvvtgmgmlspvgntvesswkallagqsgivniehfdttnfstrfaglvkgfdceq
ymskkdarkmdlfiqygiaagiqaledsglevneenaarigvaigsgigglelietghqa
liekgprkvspffvpstivnmiagnlsimrglrgpniaistacttglhnighaarmiayg
dadamvaggaekastplgmagfgaakalstrndepqkasrpwdkdrdgfvlgdgagimvl
eeyehakarga

Timeline for d4jrmc1:

• d4jrmc1 first appeared in SCOPe 2.03
  
• d4jrmc1 appears in SCOPe 2.07