Lineage for d4jrmb1 (4jrm B:3-252)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2488301Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2488302Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2489065Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 2489066Protein automated matches [196909] (62 species)
    not a true protein
  7. 2489846Species Vibrio cholerae [TaxId:243277] [226630] (3 PDB entries)
  8. 2489849Domain d4jrmb1: 4jrm B:3-252 [223963]
    automated match to d2alma1
    complexed with act, gol

Details for d4jrmb1

PDB Entry: 4jrm (more details), 1.75 Å

PDB Description: crystal structure of beta-ketoacyl-acp synthase ii (fabf) from vibrio cholerae (space group p212121) at 1.75 angstrom
PDB Compounds: (B:) 3-oxoacyl-[acyl-carrier-protein] synthase 2

SCOPe Domain Sequences for d4jrmb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jrmb1 c.95.1.0 (B:3-252) automated matches {Vibrio cholerae [TaxId: 243277]}
krrvvvtgmgmlspvgntvesswkallagqsgivniehfdttnfstrfaglvkgfdceqy
mskkdarkmdlfiqygiaagiqaledsglevneenaarigvaigsgigglelietghqal
iekgprkvspffvpstivnmiagnlsimrglrgpniaistacttglhnighaarmiaygd
adamvaggaekastplgmagfgaakalstrndepqkasrpwdkdrdgfvlgdgagimvle
eyehakarga

SCOPe Domain Coordinates for d4jrmb1:

Click to download the PDB-style file with coordinates for d4jrmb1.
(The format of our PDB-style files is described here.)

Timeline for d4jrmb1: