Lineage for d4jrma2 (4jrm A:253-414)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2916469Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2916470Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2917323Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 2917324Protein automated matches [196909] (83 species)
    not a true protein
  7. 2918368Species Vibrio cholerae [TaxId:243277] [226630] (3 PDB entries)
  8. 2918370Domain d4jrma2: 4jrm A:253-414 [223962]
    automated match to d2alma2
    complexed with act, gol

Details for d4jrma2

PDB Entry: 4jrm (more details), 1.75 Å

PDB Description: crystal structure of beta-ketoacyl-acp synthase ii (fabf) from vibrio cholerae (space group p212121) at 1.75 angstrom
PDB Compounds: (A:) 3-oxoacyl-[acyl-carrier-protein] synthase 2

SCOPe Domain Sequences for d4jrma2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jrma2 c.95.1.0 (A:253-414) automated matches {Vibrio cholerae [TaxId: 243277]}
kiyaevvgfgmsgdayhmtspsedgsggalameaamrdagvtgeqigyvnahgtstpagd
vaevkgikralgeagtkqvlvsstksmtghllgaagsveaiitvmslvdqmvpptinldn
peeglgvdlvphvarkvesmeyamcnsfgfggtngslifkrm

SCOPe Domain Coordinates for d4jrma2:

Click to download the PDB-style file with coordinates for d4jrma2.
(The format of our PDB-style files is described here.)

Timeline for d4jrma2: