Lineage for d1js4b2 (1js4 B:461-605)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 368237Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (8 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 368251Superfamily b.2.2: Carbohydrate-binding domain [49384] (3 families) (S)
  5. 368265Family b.2.2.2: Cellulose-binding domain family III [49390] (3 proteins)
  6. 368280Protein Endo/exocellulase:cellobiose E-4, C-terminal domain [49394] (2 species)
  7. 368290Species Thermomonospora fusca [TaxId:2021] [49395] (4 PDB entries)
  8. 368294Domain d1js4b2: 1js4 B:461-605 [22396]
    Other proteins in same PDB: d1js4a1, d1js4b1
    complexed with ca, glc

Details for d1js4b2

PDB Entry: 1js4 (more details), 2 Å

PDB Description: endo/exocellulase:cellobiose from thermomonospora

SCOP Domain Sequences for d1js4b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1js4b2 b.2.2.2 (B:461-605) Endo/exocellulase:cellobiose E-4, C-terminal domain {Thermomonospora fusca}
peifveaqintpgttfteikamirnqsgwparmldkgtfrywftldegvdpaditvssay
nqcatpedvhhvsgdlyyveidctgekifpggqsehrrevqfriaggpgwdpsndwsfqg
ignelapapyivlyddgvpvwgtap

SCOP Domain Coordinates for d1js4b2:

Click to download the PDB-style file with coordinates for d1js4b2.
(The format of our PDB-style files is described here.)

Timeline for d1js4b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1js4b1