Lineage for d4jrgb_ (4jrg B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712363Fold a.42: SWIB/MDM2 domain [47591] (1 superfamily)
    core: 4 helices: open bundle; capped by two small 3-stranded beta-sheets
    duplication: consists of two structural repeats
  4. 2712364Superfamily a.42.1: SWIB/MDM2 domain [47592] (2 families) (S)
    binds to the transactivation domain of human p53
  5. 2712365Family a.42.1.1: SWIB/MDM2 domain [47593] (5 proteins)
    Pfam PF02201
  6. 2712372Protein MDM2 [47594] (2 species)
  7. 2712373Species African clawed frog (Xenopus laevis) [TaxId:8355] [47595] (12 PDB entries)
    Uniprot P56273 13-119
  8. 2712382Domain d4jrgb_: 4jrg B: [223956]
    automated match to d1ycqa_
    complexed with i09

Details for d4jrgb_

PDB Entry: 4jrg (more details), 1.9 Å

PDB Description: The 1.9A crystal structure of humanized Xenopus MDM2 with RO5313109 - a pyrrolidine MDM2 inhibitor
PDB Compounds: (B:) E3 ubiquitin-protein ligase Mdm2

SCOPe Domain Sequences for d4jrgb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jrgb_ a.42.1.1 (B:) MDM2 {African clawed frog (Xenopus laevis) [TaxId: 8355]}
eklvqptplllsllksagaqketftmkevlyhlgqyimakqlydekqqhivhcsndplge
lfgvqefsvkehrriyamisrnlv

SCOPe Domain Coordinates for d4jrgb_:

Click to download the PDB-style file with coordinates for d4jrgb_.
(The format of our PDB-style files is described here.)

Timeline for d4jrgb_: