SCOPe 2.08: Domain d4jrec2: 4jre C:107-211

Lineage for d4jrec2 (4jre C:107-211)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)

8. Domain d4jrec2: 4jre C:107-211 [223952]
   Other proteins in same PDB: d4jreb_, d4jrec1, d4jreh_, d4jrel1
   automated match to d2fd6l2
   complexed with gyp, no2

Details for d4jrec2

PDB Entry: 4jre, 2.8 Å

PDB Description: crystal structure of nitrate/nitrite exchanger nark with nitrite bound

PDB Compounds: (C:) Immunoglobulin Kappa, Light chain

SCOPe Domain Sequences for d4jrec2:

Sequence; same for both SEQRES and ATOM records:

>d4jrec2 b.1.1.2 (C:107-211) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkninvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrn

Timeline for d4jrec2:

• d4jrec2 first appeared in SCOPe 2.03
  
• d4jrec2 appears in SCOPe 2.07