Lineage for d4jrec1 (4jre C:1-106)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2760693Domain d4jrec1: 4jre C:1-106 [223951]
    Other proteins in same PDB: d4jreb_, d4jrec2, d4jreh_, d4jrel2
    automated match to d2fatl1
    complexed with gyp, no2

Details for d4jrec1

PDB Entry: 4jre (more details), 2.8 Å

PDB Description: crystal structure of nitrate/nitrite exchanger nark with nitrite bound
PDB Compounds: (C:) Immunoglobulin Kappa, Light chain

SCOPe Domain Sequences for d4jrec1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jrec1 b.1.1.0 (C:1-106) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dilmtqspsslsvsvgssvtitcqasqnitnyivwyqqkpgqapklliyytstlesgips
rfsgsgsgrdysftisnlqpedvatyyclqynslltfgggtkleik

SCOPe Domain Coordinates for d4jrec1:

Click to download the PDB-style file with coordinates for d4jrec1.
(The format of our PDB-style files is described here.)

Timeline for d4jrec1: