Lineage for d4jqoa2 (4jqo A:153-334)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2906432Fold c.78: ATC-like [53670] (2 superfamilies)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134
  4. 2906433Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) (S)
  5. 2906884Family c.78.1.0: automated matches [227206] (1 protein)
    not a true family
  6. 2906885Protein automated matches [226938] (26 species)
    not a true protein
  7. 2907275Species Vibrio vulnificus [TaxId:216895] [226484] (6 PDB entries)
  8. 2907295Domain d4jqoa2: 4jqo A:153-334 [223943]
    Other proteins in same PDB: d4jqoa3, d4jqob3
    automated match to d1duvg2
    complexed with cir, cl, peg, po4

Details for d4jqoa2

PDB Entry: 4jqo (more details), 2.08 Å

PDB Description: crystal structure of anabolic ornithine carbamoyltransferase from vibrio vulnificus in complex with citrulline and inorganic phosphate
PDB Compounds: (A:) ornithine carbamoyltransferase

SCOPe Domain Sequences for d4jqoa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jqoa2 c.78.1.0 (A:153-334) automated matches {Vibrio vulnificus [TaxId: 216895]}
kaladiqfaylgdarnnvgnslmvgaakmgmdirlvgpqaywpdeelvaacqaiakqtgg
kitltenvaegvqgcdflytdvwvsmgespeawdervalmkpyqvnmnvlkqtgnpnvkf
mhclpafhndettigkqvadkfgmkglevteevfesehsivfdeaenrmhtikavmvatl
gs

SCOPe Domain Coordinates for d4jqoa2:

Click to download the PDB-style file with coordinates for d4jqoa2.
(The format of our PDB-style files is described here.)

Timeline for d4jqoa2: