Lineage for d4jqoa1 (4jqo A:1-152)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2513848Fold c.78: ATC-like [53670] (2 superfamilies)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134
  4. 2513849Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) (S)
  5. 2514304Family c.78.1.0: automated matches [227206] (1 protein)
    not a true family
  6. 2514305Protein automated matches [226938] (26 species)
    not a true protein
  7. 2514683Species Vibrio vulnificus [TaxId:216895] [226484] (6 PDB entries)
  8. 2514702Domain d4jqoa1: 4jqo A:1-152 [223942]
    Other proteins in same PDB: d4jqoa3, d4jqob3
    automated match to d1duvg1
    complexed with cir, cl, peg, po4

Details for d4jqoa1

PDB Entry: 4jqo (more details), 2.08 Å

PDB Description: crystal structure of anabolic ornithine carbamoyltransferase from vibrio vulnificus in complex with citrulline and inorganic phosphate
PDB Compounds: (A:) ornithine carbamoyltransferase

SCOPe Domain Sequences for d4jqoa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jqoa1 c.78.1.0 (A:1-152) automated matches {Vibrio vulnificus [TaxId: 216895]}
mafnlrnrnflklldfstkeiqflidlsadlkkakyagteqkkllgknialifekastrt
rcafevaafdqgaqvtyigpsgsqigdkesmkdtarvlgrmydgiqyrgfgqaiveelga
fagvpvwngltdefhptqiladfltmlehsqg

SCOPe Domain Coordinates for d4jqoa1:

Click to download the PDB-style file with coordinates for d4jqoa1.
(The format of our PDB-style files is described here.)

Timeline for d4jqoa1: