Lineage for d4jqil1 (4jqi L:1-108)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1764871Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1764872Protein automated matches [190740] (26 species)
    not a true protein
  7. 1766572Species Mouse (Mus musculus) [TaxId:10090] [188198] (413 PDB entries)
  8. 1767111Domain d4jqil1: 4jqi L:1-108 [223940]
    Other proteins in same PDB: d4jqia1, d4jqil2
    automated match to d1rhha1
    complexed with cl, edo, pro

Details for d4jqil1

PDB Entry: 4jqi (more details), 2.6 Å

PDB Description: Structure of active beta-arrestin1 bound to a G protein-coupled receptor phosphopeptide
PDB Compounds: (L:) Fab30 light chain

SCOPe Domain Sequences for d4jqil1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jqil1 b.1.1.0 (L:1-108) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
sdiqmtqspsslsasvgdrvtitcrasqsvssavawyqqkpgkapklliysasslysgvp
srfsgsrsgtdftltisslqpedfatyycqqykyvpvtfgqgtkveik

SCOPe Domain Coordinates for d4jqil1:

Click to download the PDB-style file with coordinates for d4jqil1.
(The format of our PDB-style files is described here.)

Timeline for d4jqil1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4jqil2
View in 3D
Domains from other chains:
(mouse over for more information)
d4jqia1