![]() | Class b: All beta proteins [48724] (119 folds) |
![]() | Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (8 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
![]() | Superfamily b.2.2: Carbohydrate-binding domain [49384] (3 families) ![]() |
![]() | Family b.2.2.2: Cellulose-binding domain family III [49390] (3 proteins) |
![]() | Protein Endo/exocellulase:cellobiose E-4, C-terminal domain [49394] (1 species) |
![]() | Species Thermomonospora fusca [TaxId:2021] [49395] (4 PDB entries) |
![]() | Domain d1tf4b2: 1tf4 B:461-605 [22394] Other proteins in same PDB: d1tf4a1, d1tf4b1 complexed with ca |
PDB Entry: 1tf4 (more details), 1.9 Å
SCOP Domain Sequences for d1tf4b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tf4b2 b.2.2.2 (B:461-605) Endo/exocellulase:cellobiose E-4, C-terminal domain {Thermomonospora fusca} peifveaqintpgttfteikamirnqsgwparmldkgtfrywftldegvdpaditvssay nqcatpedvhhvsgdlyyveidctgekifpggqsehrrevqfriaggpgwdpsndwsfqg ignelapapyivlyddgvpvwgtap
Timeline for d1tf4b2: