SCOPe 2.06: Domain d4jpwl2: 4jpw L:108-212

Lineage for d4jpwl2 (4jpw L:108-212)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (16 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (698 PDB entries)

8. Domain d4jpwl2: 4jpw L:108-212 [223933]
   Other proteins in same PDB: d4jpwl1
   automated match to d1rhha2
   complexed with epe, nag; mutant

Details for d4jpwl2

PDB Entry: 4jpw, 2.9 Å

PDB Description: crystal structure of broadly and potently neutralizing antibody 12a21 in complex with hiv-1 strain 93th057 gp120 mutant

PDB Compounds: (L:) light chain of antibody 12a21

SCOPe Domain Sequences for d4jpwl2:

Sequence; same for both SEQRES and ATOM records:

>d4jpwl2 b.1.1.2 (L:108-212) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglrspvtksfnrg

Timeline for d4jpwl2:

• d4jpwl2 first appeared in SCOPe 2.03
  
• d4jpwl2 appears in SCOPe 2.05
  
• d4jpwl2 appears in SCOPe 2.07
  
• d4jpwl2 appears in the current release, SCOPe 2.08