Lineage for d4josb1 (4jos B:2-228)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2887810Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2887827Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 2888846Family c.56.2.0: automated matches [191488] (1 protein)
    not a true family
  6. 2888847Protein automated matches [190781] (46 species)
    not a true protein
  7. 2889032Species Francisella philomiragia [TaxId:484022] [226629] (1 PDB entry)
  8. 2889034Domain d4josb1: 4jos B:2-228 [223926]
    Other proteins in same PDB: d4josa2, d4josb2
    automated match to d3eeia_
    complexed with ade, edo, na

Details for d4josb1

PDB Entry: 4jos (more details), 1.45 Å

PDB Description: crystal structure of a putative 5'-methylthioadenosine/s- adenosylhomocysteine nucleosidase from francisella philomiragia atcc 25017 (target nysgrc-029335)
PDB Compounds: (B:) Adenosylhomocysteine nucleosidase

SCOPe Domain Sequences for d4josb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4josb1 c.56.2.0 (B:2-228) automated matches {Francisella philomiragia [TaxId: 484022]}
kkiailgameieiqpilqklekyetveyannkyyvanyngielvvayskigkvfssltat
imiehfgvdallftgvagglqdlqvgdmiaatatvqhdvditafgypygkipiseveiat
sarileqakviakelnlnlhtgviatgdqfvhsaerkdfvvkefdakaiemegasvnlic
nemnipsfilrsisdtadgdapdnfdefakmaanrsadfvmklvdri

SCOPe Domain Coordinates for d4josb1:

Click to download the PDB-style file with coordinates for d4josb1.
(The format of our PDB-style files is described here.)

Timeline for d4josb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4josb2