![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.176: N-terminal domain of bifunctional PutA protein [81934] (1 superfamily) multihelical; array |
![]() | Superfamily a.176.1: N-terminal domain of bifunctional PutA protein [81935] (2 families) ![]() |
![]() | Family a.176.1.0: automated matches [227131] (1 protein) not a true family |
![]() | Protein automated matches [226832] (2 species) not a true protein |
![]() | Species Escherichia coli K-12 [TaxId:83333] [224852] (5 PDB entries) |
![]() | Domain d4jnza1: 4jnz A:87-261 [223921] Other proteins in same PDB: d4jnza2 automated match to d1tj1a1 complexed with 1pe, fad, tfb; mutant |
PDB Entry: 4jnz (more details), 1.85 Å
SCOPe Domain Sequences for d4jnza1:
Sequence, based on SEQRES records: (download)
>d4jnza1 a.176.1.0 (A:87-261) automated matches {Escherichia coli K-12 [TaxId: 83333]} pqsvsraaitaayrrpeteavsmlleqarlpqpvaeqahklayqladklrnqknasgrag mvqgllqefslssqegvalmclaeallripdkatrdalirdkisngnwqshigrspslfv naatwgllftgklvsthneaslsrslnriigksgeplirkgvdmamrlmgeqfvt
>d4jnza1 a.176.1.0 (A:87-261) automated matches {Escherichia coli K-12 [TaxId: 83333]} pqsvsraaitaayrrpeteavsmlleqarlpqpvaeqahklayqladklrnqknasgrag mvqgllqefslssqegvalmclaeallripdkatrdalirdlfvnaatwgllfaslsrsl nriiplirkgvdmamrlmgeqfvt
Timeline for d4jnza1: