![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
![]() | Superfamily b.2.2: Carbohydrate-binding domain [49384] (3 families) ![]() |
![]() | Family b.2.2.2: Cellulose-binding domain family III [49390] (8 proteins) Pfam PF00963 |
![]() | Protein Cellusomal scaffolding protein A, scaffoldin [49391] (2 species) |
![]() | Species Clostridium cellulolyticum [TaxId:1521] [49393] (1 PDB entry) |
![]() | Domain d1g43a_: 1g43 A: [22392] complexed with ca, zn |
PDB Entry: 1g43 (more details), 2.2 Å
SCOP Domain Sequences for d1g43a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g43a_ b.2.2.2 (A:) Cellusomal scaffolding protein A, scaffoldin {Clostridium cellulolyticum [TaxId: 1521]} agtgvvsvqfnngsspassnsiyarfkvtntsgspinladlklryyytqdadkpltfwcd hagymsgsnyidatskvtgsfkavspavtnadhylevalnsdagslpaggsieiqtrfar ndwsnfdqsndwsytaagsymdwqkisafvggtlaygstp
Timeline for d1g43a_: