Lineage for d1g43a_ (1g43 A:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (7 superfamilies) 
Superfamily b.2.2: Carbohydrate-binding domain [49384] (3 families) 
Family b.2.2.2: Cellulose-binding domain family III [49390] (3 proteins) 
Protein Cellusomal scaffolding protein A, scafoldin [49391] (2 species) 
Species Clostridium cellulolyticum [TaxId:1521] [49393] (1 PDB entry) 
Domain d1g43a_: 1g43 A: [22392]
Details for d1g43a_
PDB Entry: 1g43 (more details), 2.2 Å
PDB Description: crystal structure of a family iiia cbd from clostridium cellulolyticum
SCOP Domain Sequences for d1g43a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g43a_ b.2.2.2 (A:) Cellusomal scaffolding protein A, scafoldin {Clostridium cellulolyticum}
agtgvvsvqfnngsspassnsiyarfkvtntsgspinladlklryyytqdadkpltfwcd
hagymsgsnyidatskvtgsfkavspavtnadhylevalnsdagslpaggsieiqtrfar
ndwsnfdqsndwsytaagsymdwqkisafvggtlaygstp
SCOP Domain Coordinates for d1g43a_:
Click to download the PDB-style file with coordinates for d1g43a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1g43a_:
- d1g43a_ appears in SCOP 1.57
- d1g43a_ appears in the current release, SCOPe 2.08
View in 3D