SCOPe 2.08: Domain d1g43a_: 1g43 A:

Lineage for d1g43a_ (1g43 A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families)

5. Family b.2.2.2: Cellulose-binding domain family III [49390] (9 proteins)
   Pfam PF00963

6. Protein Cellusomal scaffolding protein A, scaffoldin [49391] (3 species)

7. Species Clostridium cellulolyticum [TaxId:1521] [49393] (1 PDB entry)

8. Domain d1g43a_: 1g43 A: [22392]
   complexed with ca, zn

Details for d1g43a_

PDB Entry: 1g43, 2.2 Å

PDB Description: crystal structure of a family iiia cbd from clostridium cellulolyticum

PDB Compounds: (A:) scaffolding protein

SCOPe Domain Sequences for d1g43a_:

Sequence; same for both SEQRES and ATOM records:

>d1g43a_ b.2.2.2 (A:) Cellusomal scaffolding protein A, scaffoldin {Clostridium cellulolyticum [TaxId: 1521]}
agtgvvsvqfnngsspassnsiyarfkvtntsgspinladlklryyytqdadkpltfwcd
hagymsgsnyidatskvtgsfkavspavtnadhylevalnsdagslpaggsieiqtrfar
ndwsnfdqsndwsytaagsymdwqkisafvggtlaygstp

Timeline for d1g43a_:

• d1g43a_ first appeared (with stable ids) in SCOP 1.55
  
• d1g43a_ appears in SCOPe 2.07