Class a: All alpha proteins [46456] (289 folds) |
Fold a.176: N-terminal domain of bifunctional PutA protein [81934] (1 superfamily) multihelical; array |
Superfamily a.176.1: N-terminal domain of bifunctional PutA protein [81935] (2 families) |
Family a.176.1.0: automated matches [227131] (1 protein) not a true family |
Protein automated matches [226832] (2 species) not a true protein |
Species Escherichia coli K-12 [TaxId:83333] [224852] (5 PDB entries) |
Domain d4jnya1: 4jny A:87-261 [223919] Other proteins in same PDB: d4jnya2 automated match to d1tj1a1 complexed with 1pe, fad, tfb; mutant |
PDB Entry: 4jny (more details), 1.9 Å
SCOPe Domain Sequences for d4jnya1:
Sequence, based on SEQRES records: (download)
>d4jnya1 a.176.1.0 (A:87-261) automated matches {Escherichia coli K-12 [TaxId: 83333]} pqsvsraaitaayrrpeteavsmlleqarlpqpvaeqahklayqladklrnqknasgrag mvqgllqefslssqegvalmclaeallripdkatrdalirdkisngnwqshigrspslfv naatwgllftgklvsthneaslsrslnriigksgeplirkgvdmamrlmgeqfvt
>d4jnya1 a.176.1.0 (A:87-261) automated matches {Escherichia coli K-12 [TaxId: 83333]} pqsvsraaitaayrrpeteavsmlleqarlpqpvaeqahklayqladklrnqknasgrag mvqgllqefslssqegvalmclaeallripdkatrdallfvnaatwgllfaslsrslnri ieplirkgvdmamrlmgeqfvt
Timeline for d4jnya1: