Lineage for d4jnya1 (4jny A:87-261)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2018271Fold a.176: N-terminal domain of bifunctional PutA protein [81934] (1 superfamily)
    multihelical; array
  4. 2018272Superfamily a.176.1: N-terminal domain of bifunctional PutA protein [81935] (2 families) (S)
  5. 2018286Family a.176.1.0: automated matches [227131] (1 protein)
    not a true family
  6. 2018287Protein automated matches [226832] (2 species)
    not a true protein
  7. 2018288Species Escherichia coli K-12 [TaxId:83333] [224852] (5 PDB entries)
  8. 2018292Domain d4jnya1: 4jny A:87-261 [223919]
    Other proteins in same PDB: d4jnya2
    automated match to d1tj1a1
    complexed with 1pe, fad, tfb; mutant

Details for d4jnya1

PDB Entry: 4jny (more details), 1.9 Å

PDB Description: crystal structure of puta86-630 mutant d370a complexed with l- tetrahydro-2-furoic acid
PDB Compounds: (A:) Bifunctional protein putA

SCOPe Domain Sequences for d4jnya1:

Sequence, based on SEQRES records: (download)

>d4jnya1 a.176.1.0 (A:87-261) automated matches {Escherichia coli K-12 [TaxId: 83333]}
pqsvsraaitaayrrpeteavsmlleqarlpqpvaeqahklayqladklrnqknasgrag
mvqgllqefslssqegvalmclaeallripdkatrdalirdkisngnwqshigrspslfv
naatwgllftgklvsthneaslsrslnriigksgeplirkgvdmamrlmgeqfvt

Sequence, based on observed residues (ATOM records): (download)

>d4jnya1 a.176.1.0 (A:87-261) automated matches {Escherichia coli K-12 [TaxId: 83333]}
pqsvsraaitaayrrpeteavsmlleqarlpqpvaeqahklayqladklrnqknasgrag
mvqgllqefslssqegvalmclaeallripdkatrdallfvnaatwgllfaslsrslnri
ieplirkgvdmamrlmgeqfvt

SCOPe Domain Coordinates for d4jnya1:

Click to download the PDB-style file with coordinates for d4jnya1.
(The format of our PDB-style files is described here.)

Timeline for d4jnya1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4jnya2