Lineage for d1nbcb_ (1nbc B:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1112569Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 1112583Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families) (S)
  5. 1112597Family b.2.2.2: Cellulose-binding domain family III [49390] (9 proteins)
    Pfam PF00963
  6. 1112609Protein Cellusomal scaffolding protein A, scaffoldin [49391] (3 species)
  7. 1112612Species Clostridium thermocellum [TaxId:1515] [49392] (1 PDB entry)
  8. 1112614Domain d1nbcb_: 1nbc B: [22391]
    complexed with ca

Details for d1nbcb_

PDB Entry: 1nbc (more details), 1.75 Å

PDB Description: bacterial type 3a cellulose-binding domain
PDB Compounds: (B:) cellulosomal scaffolding protein a

SCOPe Domain Sequences for d1nbcb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nbcb_ b.2.2.2 (B:) Cellusomal scaffolding protein A, scaffoldin {Clostridium thermocellum [TaxId: 1515]}
nlkvefynsnpsdttnsinpqfkvtntgssaidlskltlryyytvdgqkdqtfwcdhaai
igsngsyngitsnvkgtfvkmssstnnadtyleisftggtlepgahvqiqgrfakndwsn
ytqsndysfksasqfvewdqvtaylngvlvwgkep

SCOPe Domain Coordinates for d1nbcb_:

Click to download the PDB-style file with coordinates for d1nbcb_.
(The format of our PDB-style files is described here.)

Timeline for d1nbcb_: