Lineage for d1nbcb_ (1nbc B:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 10320Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (7 superfamilies)
  4. 10334Superfamily b.2.2: Carbohydrate-binding domain [49384] (3 families) (S)
  5. 10344Family b.2.2.2: Cellulose-binding domain family III [49390] (3 proteins)
  6. 10345Protein Cellusomal scaffolding protein A, scafoldin [49391] (2 species)
  7. 10348Species Clostridium thermocellum [TaxId:1515] [49392] (1 PDB entry)
  8. 10350Domain d1nbcb_: 1nbc B: [22391]

Details for d1nbcb_

PDB Entry: 1nbc (more details), 1.8 Å

PDB Description: bacterial type 3a cellulose-binding domain

SCOP Domain Sequences for d1nbcb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nbcb_ b.2.2.2 (B:) Cellusomal scaffolding protein A, scafoldin {Clostridium thermocellum}
nlkvefynsnpsdttnsinpqfkvtntgssaidlskltlryyytvdgqkdqtfwcdhaai
igsngsyngitsnvkgtfvkmssstnnadtyleisftggtlepgahvqiqgrfakndwsn
ytqsndysfksasqfvewdqvtaylngvlvwgkep

SCOP Domain Coordinates for d1nbcb_:

Click to download the PDB-style file with coordinates for d1nbcb_.
(The format of our PDB-style files is described here.)

Timeline for d1nbcb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1nbca_