SCOP 1.55: Domain d1nbcb_: 1nbc B:

Lineage for d1nbcb_ (1nbc B:)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (7 superfamilies)

4. Superfamily b.2.2: Carbohydrate-binding domain [49384] (3 families)

5. Family b.2.2.2: Cellulose-binding domain family III [49390] (3 proteins)

6. Protein Cellusomal scaffolding protein A, scafoldin [49391] (2 species)

7. Species Clostridium thermocellum [TaxId:1515] [49392] (1 PDB entry)

8. Domain d1nbcb_: 1nbc B: [22391]

Details for d1nbcb_

PDB Entry: 1nbc, 1.8 Å

PDB Description: bacterial type 3a cellulose-binding domain

SCOP Domain Sequences for d1nbcb_:

Sequence; same for both SEQRES and ATOM records:

>d1nbcb_ b.2.2.2 (B:) Cellusomal scaffolding protein A, scafoldin {Clostridium thermocellum}
nlkvefynsnpsdttnsinpqfkvtntgssaidlskltlryyytvdgqkdqtfwcdhaai
igsngsyngitsnvkgtfvkmssstnnadtyleisftggtlepgahvqiqgrfakndwsn
ytqsndysfksasqfvewdqvtaylngvlvwgkep

Timeline for d1nbcb_:

• d1nbcb_ appears in SCOP 1.57
  
• d1nbcb_ appears in the current release, SCOPe 2.08