![]() | Class b: All beta proteins [48724] (93 folds) |
![]() | Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (7 superfamilies) |
![]() | Superfamily b.2.2: Carbohydrate-binding domain [49384] (3 families) ![]() |
![]() | Family b.2.2.2: Cellulose-binding domain family III [49390] (3 proteins) |
![]() | Protein Cellusomal scaffolding protein A, scafoldin [49391] (2 species) |
![]() | Species Clostridium thermocellum [TaxId:1515] [49392] (1 PDB entry) |
![]() | Domain d1nbcb_: 1nbc B: [22391] |
PDB Entry: 1nbc (more details), 1.8 Å
SCOP Domain Sequences for d1nbcb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nbcb_ b.2.2.2 (B:) Cellusomal scaffolding protein A, scafoldin {Clostridium thermocellum} nlkvefynsnpsdttnsinpqfkvtntgssaidlskltlryyytvdgqkdqtfwcdhaai igsngsyngitsnvkgtfvkmssstnnadtyleisftggtlepgahvqiqgrfakndwsn ytqsndysfksasqfvewdqvtaylngvlvwgkep
Timeline for d1nbcb_: