SCOPe 2.05: Domain d4jnfa1: 4jnf A:388-506

Lineage for d4jnfa1 (4jnf A:388-506)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.130: Heat shock protein 70kD (HSP70), peptide-binding domain [100919] (1 superfamily)
   beta-sandwich: 8 strands in 2 sheets

4. Superfamily b.130.1: Heat shock protein 70kD (HSP70), peptide-binding domain [100920] (1 family)

5. Family b.130.1.1: Heat shock protein 70kD (HSP70), peptide-binding domain [100921] (3 proteins)

6. Protein automated matches [227117] (2 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [226638] (2 PDB entries)

8. Domain d4jnfa1: 4jnf A:388-506 [223909]
   Other proteins in same PDB: d4jnfa2
   automated match to d1dkza2

Details for d4jnfa1

PDB Entry: 4jnf, 1.62 Å

PDB Description: allosteric opening of the polypeptide-binding site when an hsp70 binds atp

PDB Compounds: (A:) Hsp70 CHAPERONE DnaK

SCOPe Domain Sequences for d4jnfa1:

Sequence; same for both SEQRES and ATOM records:

>d4jnfa1 b.130.1.1 (A:388-506) automated matches {Escherichia coli K-12 [TaxId: 83333]}
svllldvtplslgietmggvmttliaknttiptkhsqvfsmggavtihvlqgerkraadn
kslgqfnldginpaprgmpqievtfdidadgilhvsakdknsgkeqkitikassg

Timeline for d4jnfa1:

• d4jnfa1 first appeared in SCOPe 2.03
  
• d4jnfa1 appears in SCOPe 2.04
  
• d4jnfa1 appears in SCOPe 2.06
  
• d4jnfa1 appears in the current release, SCOPe 2.08