![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.130: Heat shock protein 70kD (HSP70), peptide-binding domain [100919] (1 superfamily) beta-sandwich: 8 strands in 2 sheets |
![]() | Superfamily b.130.1: Heat shock protein 70kD (HSP70), peptide-binding domain [100920] (1 family) ![]() |
![]() | Family b.130.1.1: Heat shock protein 70kD (HSP70), peptide-binding domain [100921] (3 proteins) |
![]() | Protein automated matches [227117] (1 species) not a true protein |
![]() | Species Escherichia coli [TaxId:83333] [226638] (2 PDB entries) |
![]() | Domain d4jnfa1: 4jnf A:388-506 [223909] Other proteins in same PDB: d4jnfa2 automated match to d1dkza2 |
PDB Entry: 4jnf (more details), 1.62 Å
SCOPe Domain Sequences for d4jnfa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4jnfa1 b.130.1.1 (A:388-506) automated matches {Escherichia coli [TaxId: 83333]} svllldvtplslgietmggvmttliaknttiptkhsqvfsmggavtihvlqgerkraadn kslgqfnldginpaprgmpqievtfdidadgilhvsakdknsgkeqkitikassg
Timeline for d4jnfa1: