Lineage for d4jn6a2 (4jn6 A:289-341)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2696009Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
    3 helices; bundle, right-handed twist
  4. 2696293Superfamily a.5.7: post-HMGL domain-like [89000] (3 families) (S)
  5. 2696314Family a.5.7.0: automated matches [227294] (1 protein)
    not a true family
  6. 2696315Protein automated matches [227119] (2 species)
    not a true protein
  7. 2696316Species Mycobacterium tuberculosis [TaxId:1773] [226658] (1 PDB entry)
  8. 2696317Domain d4jn6a2: 4jn6 A:289-341 [223906]
    Other proteins in same PDB: d4jn6a1, d4jn6c1
    automated match to d1nvmc1
    complexed with mn, na, oxl

Details for d4jn6a2

PDB Entry: 4jn6 (more details), 1.93 Å

PDB Description: Crystal Structure of the Aldolase-Dehydrogenase Complex from Mycobacterium tuberculosis HRv37
PDB Compounds: (A:) 4-hydroxy-2-oxovalerate aldolase

SCOPe Domain Sequences for d4jn6a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jn6a2 a.5.7.0 (A:289-341) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
yssflkhavrqaerygvpasallhragqrkliggqedqlidialeikreldsg

SCOPe Domain Coordinates for d4jn6a2:

Click to download the PDB-style file with coordinates for d4jn6a2.
(The format of our PDB-style files is described here.)

Timeline for d4jn6a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4jn6a1