SCOPe 2.08: Domain d4jn6a2: 4jn6 A:289-341

Lineage for d4jn6a2 (4jn6 A:289-341)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
   3 helices; bundle, right-handed twist

4. Superfamily a.5.7: post-HMGL domain-like [89000] (3 families)

5. Family a.5.7.0: automated matches [227294] (1 protein)
   not a true family

6. Protein automated matches [227119] (2 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:1773] [226658] (1 PDB entry)

8. Domain d4jn6a2: 4jn6 A:289-341 [223906]
   Other proteins in same PDB: d4jn6a1, d4jn6c1
   automated match to d1nvmc1
   complexed with mn, na, oxl

Details for d4jn6a2

PDB Entry: 4jn6, 1.93 Å

PDB Description: Crystal Structure of the Aldolase-Dehydrogenase Complex from Mycobacterium tuberculosis HRv37

PDB Compounds: (A:) 4-hydroxy-2-oxovalerate aldolase

SCOPe Domain Sequences for d4jn6a2:

Sequence; same for both SEQRES and ATOM records:

>d4jn6a2 a.5.7.0 (A:289-341) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
yssflkhavrqaerygvpasallhragqrkliggqedqlidialeikreldsg

Timeline for d4jn6a2:

• d4jn6a2 first appeared in SCOPe 2.03
  
• d4jn6a2 appears in SCOPe 2.07