![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
![]() | Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families) ![]() |
![]() | Family b.2.2.2: Cellulose-binding domain family III [49390] (9 proteins) Pfam PF00963 |
![]() | Protein Cellusomal scaffolding protein A, scaffoldin [49391] (3 species) |
![]() | Species Clostridium thermocellum [TaxId:1515] [49392] (1 PDB entry) |
![]() | Domain d1nbca_: 1nbc A: [22390] complexed with ca |
PDB Entry: 1nbc (more details), 1.75 Å
SCOPe Domain Sequences for d1nbca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nbca_ b.2.2.2 (A:) Cellusomal scaffolding protein A, scaffoldin {Clostridium thermocellum [TaxId: 1515]} nlkvefynsnpsdttnsinpqfkvtntgssaidlskltlryyytvdgqkdqtfwcdhaai igsngsyngitsnvkgtfvkmssstnnadtyleisftggtlepgahvqiqgrfakndwsn ytqsndysfksasqfvewdqvtaylngvlvwgkep
Timeline for d1nbca_: