SCOP 1.75: Domain d1nbca_: 1nbc A:

Lineage for d1nbca_ (1nbc A:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.2: Carbohydrate-binding domain [49384] (3 families)

5. Family b.2.2.2: Cellulose-binding domain family III [49390] (8 proteins)
   Pfam PF00963

6. Protein Cellusomal scaffolding protein A, scaffoldin [49391] (2 species)

7. Species Clostridium thermocellum [TaxId:1515] [49392] (1 PDB entry)

8. Domain d1nbca_: 1nbc A: [22390]

Details for d1nbca_

PDB Entry: 1nbc, 1.75 Å

PDB Description: bacterial type 3a cellulose-binding domain

PDB Compounds: (A:) cellulosomal scaffolding protein a

SCOP Domain Sequences for d1nbca_:

Sequence; same for both SEQRES and ATOM records:

>d1nbca_ b.2.2.2 (A:) Cellusomal scaffolding protein A, scaffoldin {Clostridium thermocellum [TaxId: 1515]}
nlkvefynsnpsdttnsinpqfkvtntgssaidlskltlryyytvdgqkdqtfwcdhaai
igsngsyngitsnvkgtfvkmssstnnadtyleisftggtlepgahvqiqgrfakndwsn
ytqsndysfksasqfvewdqvtaylngvlvwgkep

Timeline for d1nbca_:

• d1nbca_ first appeared (with stable ids) in SCOP 1.55
  
• d1nbca_ appears in SCOP 1.73
  
• d1nbca_ appears in SCOPe 2.01
  
• d1nbca_ appears in the current release, SCOPe 2.08