![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
![]() | Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) ![]() |
![]() | Family d.108.1.0: automated matches [191308] (1 protein) not a true family |
![]() | Protein automated matches [190038] (22 species) not a true protein |
![]() | Species Vibrio cholerae [TaxId:666] [188612] (8 PDB entries) |
![]() | Domain d4jlyf_: 4jly F: [223893] automated match to d3eg7a_ complexed with so4 |
PDB Entry: 4jly (more details), 2.88 Å
SCOPe Domain Sequences for d4jlyf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4jlyf_ d.108.1.0 (F:) automated matches {Vibrio cholerae [TaxId: 666]} nsqltlralergdlrfihnlnnnrnimsywfeepyesfdeleelynkhihdnaerrfvve daqknliglvelieinyihrsaefqiiiapehqgkgfartlinraldysftilnlhkiyl hvavenpkavhlyeecgfveeghlveeffingryqdvkrmyilqskylnr
Timeline for d4jlyf_: