Lineage for d4jlga2 (4jlg A:194-363)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1332308Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 1332852Superfamily b.85.7: SET domain [82199] (4 families) (S)
    duplication: the core is composed of two structural repeats similar to (circularly permuted) repeats of AFPIII
    also contains a substrate-binding alpha+beta subdomain inserted in the core
  5. 1332853Family b.85.7.1: Histone lysine methyltransferases [82200] (3 proteins)
    contains metal-binding preSET and postSET domains
  6. 1332859Protein Histone H3 K4-specific methyltransferase SET7/9 catalytic domain [82205] (1 species)
  7. 1332860Species Human (Homo sapiens) [TaxId:9606] [82206] (17 PDB entries)
    Uniprot Q8WTS6 52-336
  8. 1332874Domain d4jlga2: 4jlg A:194-363 [223884]
    Other proteins in same PDB: d4jlga1, d4jlgb1
    automated match to d3cbpa2
    complexed with 1l8, sam, unx

Details for d4jlga2

PDB Entry: 4jlg (more details), 1.9 Å

PDB Description: SETD7 in complex with inhibitor (R)-PFI-2 and S-adenosyl-methionine
PDB Compounds: (A:) Histone-lysine N-methyltransferase SETD7

SCOPe Domain Sequences for d4jlga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jlga2 b.85.7.1 (A:194-363) Histone H3 K4-specific methyltransferase SET7/9 catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
dkstsscistnallpdpyeservyvaeslissageglfskvavgpntvmsfyngvrithq
evdsrdwalngntlsldeetvidvpepynhvskycaslghkanhsftpnciydmfvhprf
gpikcirtlraveadeeltvaygydhsppgksgpeapewyqvelkafqat

SCOPe Domain Coordinates for d4jlga2:

Click to download the PDB-style file with coordinates for d4jlga2.
(The format of our PDB-style files is described here.)

Timeline for d4jlga2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4jlga1