Lineage for d4jkwa1 (4jkw A:3-116)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2031996Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2031997Protein automated matches [190740] (28 species)
    not a true protein
  7. 2032126Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries)
  8. 2032508Domain d4jkwa1: 4jkw A:3-116 [223882]
    Other proteins in same PDB: d4jkwa2
    automated match to d1pkqe_
    complexed with ipe

Details for d4jkwa1

PDB Entry: 4jkw (more details), 2.01 Å

PDB Description: Structure of the extracellular domain of butyrophilin BTN3A1 in complex with Isopentenyl pyrophosphate (IPP)
PDB Compounds: (A:) Butyrophilin subfamily 3 member A1

SCOPe Domain Sequences for d4jkwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jkwa1 b.1.1.0 (A:3-116) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qfsvlgpsgpilamvgedadlpchlfptmsaetmelkwvssslrqvvnvyadgkevedrq
sapyrgrtsilrdgitagkaalrihnvtasdsgkylcyfqdgdfyekalvelkv

SCOPe Domain Coordinates for d4jkwa1:

Click to download the PDB-style file with coordinates for d4jkwa1.
(The format of our PDB-style files is described here.)

Timeline for d4jkwa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4jkwa2