Lineage for d2xbda_ (2xbd A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2767182Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2767216Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families) (S)
  5. 2767217Family b.2.2.1: Cellulose-binding domain family II [49385] (3 proteins)
    automatically mapped to Pfam PF00553
  6. 2767218Protein Endo-1,4-beta xylanase D, xylan binding domain, XBD [49388] (1 species)
    belongs to subfamily IIb
  7. 2767219Species Cellulomonas fimi [TaxId:1708] [49389] (6 PDB entries)
  8. 2767220Domain d2xbda_: 2xbd A: [22388]
    XBD1

Details for d2xbda_

PDB Entry: 2xbd (more details)

PDB Description: internal xylan binding domain from cellulomonas fimi xylanase d, nmr, minimized average structure
PDB Compounds: (A:) xylanase d

SCOPe Domain Sequences for d2xbda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xbda_ b.2.2.1 (A:) Endo-1,4-beta xylanase D, xylan binding domain, XBD {Cellulomonas fimi [TaxId: 1708]}
tgcsvtatraeewsdrfnvtysvsgssawtvnlalngsqtiqaswnanvtgsgstrtvtp
ngsgntfgvtvmkngssttpaatcags

SCOPe Domain Coordinates for d2xbda_:

Click to download the PDB-style file with coordinates for d2xbda_.
(The format of our PDB-style files is described here.)

Timeline for d2xbda_: