SCOPe 2.08: Domain d2xbda_: 2xbd A:

Lineage for d2xbda_ (2xbd A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families)

5. Family b.2.2.1: Cellulose-binding domain family II [49385] (3 proteins)
   automatically mapped to Pfam PF00553

6. Protein Endo-1,4-beta xylanase D, xylan binding domain, XBD [49388] (1 species)
   belongs to subfamily IIb

7. Species Cellulomonas fimi [TaxId:1708] [49389] (6 PDB entries)

8. Domain d2xbda_: 2xbd A: [22388]
   XBD1

Details for d2xbda_

PDB Entry: 2xbd

PDB Description: internal xylan binding domain from cellulomonas fimi xylanase d, nmr, minimized average structure

PDB Compounds: (A:) xylanase d

SCOPe Domain Sequences for d2xbda_:

Sequence; same for both SEQRES and ATOM records:

>d2xbda_ b.2.2.1 (A:) Endo-1,4-beta xylanase D, xylan binding domain, XBD {Cellulomonas fimi [TaxId: 1708]}
tgcsvtatraeewsdrfnvtysvsgssawtvnlalngsqtiqaswnanvtgsgstrtvtp
ngsgntfgvtvmkngssttpaatcags

Timeline for d2xbda_:

• d2xbda_ first appeared (with stable ids) in SCOP 1.55, called d2xbd__
  
• d2xbda_ appears in SCOPe 2.07