SCOPe 2.06: Domain d4jkpl2: 4jkp L:102-209

Lineage for d4jkpl2 (4jkp L:102-209)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (28 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries)

8. Domain d4jkpl2: 4jkp L:102-209 [223877]
   automated match to d1z3gl2
   complexed with nag

Details for d4jkpl2

PDB Entry: 4jkp, 2.82 Å

PDB Description: restricting hiv-1 pathways for escape using rationally-designed anti- hiv-1 antibodies

PDB Compounds: (L:) Light chain of antibody 45-46M2

SCOPe Domain Sequences for d4jkpl2:

Sequence; same for both SEQRES and ATOM records:

>d4jkpl2 b.1.1.0 (L:102-209) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ikrtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvte
qdskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

Timeline for d4jkpl2:

• d4jkpl2 first appeared in SCOPe 2.03
  
• d4jkpl2 appears in SCOPe 2.05
  
• d4jkpl2 appears in SCOPe 2.07
  
• d4jkpl2 appears in the current release, SCOPe 2.08