Lineage for d4jkpl1 (4jkp L:3-101)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (24 species)
    not a true protein
  7. 2355363Species Human (Homo sapiens) [TaxId:9606] [187920] (1030 PDB entries)
  8. 2357289Domain d4jkpl1: 4jkp L:3-101 [223876]
    automated match to d1sy6l1
    complexed with bma, man, nag

Details for d4jkpl1

PDB Entry: 4jkp (more details), 2.82 Å

PDB Description: restricting hiv-1 pathways for escape using rationally-designed anti- hiv-1 antibodies
PDB Compounds: (L:) Light chain of antibody 45-46M2

SCOPe Domain Sequences for d4jkpl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jkpl1 b.1.1.0 (L:3-101) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vltqspatlslspgetaiiscrtsqygslawyqqrpgqaprlviysgstraagipdrfsg
srwgadynlsisnlesgdfgvyycqqyeffgqgtkvqvd

SCOPe Domain Coordinates for d4jkpl1:

Click to download the PDB-style file with coordinates for d4jkpl1.
(The format of our PDB-style files is described here.)

Timeline for d4jkpl1: