SCOPe 2.05: Domain d1exga_: 1exg A:

Lineage for d1exga_ (1exg A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families)

5. Family b.2.2.1: Cellulose-binding domain family II [49385] (2 proteins)
   automatically mapped to Pfam PF00553

6. Protein Exo-1,4-beta-D-glycanase (cellulase, xylanase), cellulose-binding domain, CBD [49386] (1 species)
   belongs to subfamily IIa

7. Species Cellulomonas fimi [TaxId:1708] [49387] (2 PDB entries)

8. Domain d1exga_: 1exg A: [22387]

Details for d1exga_

PDB Entry: 1exg

PDB Description: solution structure of a cellulose binding domain from cellulomonas fimi by nuclear magnetic resonance spectroscopy

PDB Compounds: (A:) exo-1,4-beta-d-glycanase

SCOPe Domain Sequences for d1exga_:

Sequence; same for both SEQRES and ATOM records:

>d1exga_ b.2.2.1 (A:) Exo-1,4-beta-D-glycanase (cellulase, xylanase), cellulose-binding domain, CBD {Cellulomonas fimi [TaxId: 1708]}
assgpagcqvlwgvnqwntgftanvtvkntssapvdgwtltfsfpsgqqvtqawsstvtq
sgsavtvrnapwngsipaggtaqfgfngshtgtnaaptafslngtpctvg

Timeline for d1exga_:

• d1exga_ first appeared (with stable ids) in SCOP 1.55, called d1exg__
  
• d1exga_ appears in SCOPe 2.04
  
• d1exga_ appears in SCOPe 2.06
  
• d1exga_ appears in the current release, SCOPe 2.08