Class b: All beta proteins [48724] (176 folds) |
Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families) |
Family b.2.2.1: Cellulose-binding domain family II [49385] (2 proteins) automatically mapped to Pfam PF00553 |
Protein Exo-1,4-beta-D-glycanase (cellulase, xylanase), cellulose-binding domain, CBD [49386] (1 species) belongs to subfamily IIa |
Species Cellulomonas fimi [TaxId:1708] [49387] (2 PDB entries) |
Domain d1exga_: 1exg A: [22387] |
PDB Entry: 1exg (more details)
SCOPe Domain Sequences for d1exga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1exga_ b.2.2.1 (A:) Exo-1,4-beta-D-glycanase (cellulase, xylanase), cellulose-binding domain, CBD {Cellulomonas fimi [TaxId: 1708]} assgpagcqvlwgvnqwntgftanvtvkntssapvdgwtltfsfpsgqqvtqawsstvtq sgsavtvrnapwngsipaggtaqfgfngshtgtnaaptafslngtpctvg
Timeline for d1exga_: