Lineage for d1exg__ (1exg -)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (7 superfamilies) 
Superfamily b.2.2: Carbohydrate-binding domain [49384] (3 families) 
Family b.2.2.1: Cellulose-binding domain family II [49385] (2 proteins) 
Protein Exo-1,4-beta-D-glycanase (cellulase, xylanase) [49386] (1 species) Species Cellulomonas fimi [TaxId:1708] [49387] (2 PDB entries) 
Domain d1exg__: 1exg - [22387]
Details for d1exg__
PDB Entry: 1exg (more details)
PDB Description: solution structure of a cellulose binding domain from cellulomonas fimi by nuclear magnetic resonance spectroscopy
SCOP Domain Sequences for d1exg__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1exg__ b.2.2.1 (-) Exo-1,4-beta-D-glycanase (cellulase, xylanase) {Cellulomonas fimi}
assgpagcqvlwgvnqwntgftanvtvkntssapvdgwtltfsfpsgqqvtqawsstvtq
sgsavtvrnapwngsipaggtaqfgfngshtgtnaaptafslngtpctvg
SCOP Domain Coordinates for d1exg__:
Click to download the PDB-style file with coordinates for d1exg__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1exg__:
- d1exg__ appears in SCOP 1.57
- d1exg__ appears in the current release, SCOPe 2.08, called d1exga_
View in 3D