Lineage for d4jkea_ (4jke A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1857400Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1859086Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) (S)
    consists of one domain of this fold
  5. 1860153Family c.55.3.14: Prp8 beta-finger domain-like [159638] (2 proteins)
    automatically mapped to Pfam PF12134
  6. 1860154Protein Pre-mRNA-splicing factor 8, Prp8 [159639] (3 species)
  7. 1860166Species Human (Homo sapiens) [TaxId:9606] [159640] (13 PDB entries)
    Uniprot Q6P2Q9 1760-2016! Uniprot Q6P2Q9 1771-1989
  8. 1860181Domain d4jkea_: 4jke A: [223866]
    automated match to d3enba1
    complexed with mg

Details for d4jkea_

PDB Entry: 4jke (more details), 1.65 Å

PDB Description: Open and closed forms of T1789P human PRP8 RNase H-like domain with bound Mg ion
PDB Compounds: (A:) Pre-mRNA-processing-splicing factor 8

SCOPe Domain Sequences for d4jkea_:

Sequence, based on SEQRES records: (download)

>d4jkea_ c.55.3.14 (A:) Pre-mRNA-splicing factor 8, Prp8 {Human (Homo sapiens) [TaxId: 9606]}
lfsnqiiwfvddtnvyrvpihktfegnlttkpingaififnprtgqlflkiihtsvwagq
krlgqlakwktaeevaalirslpveeqpkqiivtrkgmldplevhlldfpnivikgselq
lpfqaclkvekfgdlilkatepqmvlfnlyddwlktissytafsrlililralhvnndra
kvilkpdkttitephhiwptltdeewikvevqlkdlilad

Sequence, based on observed residues (ATOM records): (download)

>d4jkea_ c.55.3.14 (A:) Pre-mRNA-splicing factor 8, Prp8 {Human (Homo sapiens) [TaxId: 9606]}
lfsqiiwfvddtnvyrvpihktfegnlttkpingaififnprtgqlflkiihtsvwagqk
rlgqlakwktaeevaalirslpveeqpkqiivtrkgmldplevhlldfpnivikgselql
pfqaclkvekfgdlilkatepqmvlfnlyddwlktissytafsrlililralhvnndrak
vilkpdkttitephhiwptltdeewikvevqlkdlilad

SCOPe Domain Coordinates for d4jkea_:

Click to download the PDB-style file with coordinates for d4jkea_.
(The format of our PDB-style files is described here.)

Timeline for d4jkea_: