Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) consists of one domain of this fold |
Family c.55.3.14: Prp8 beta-finger domain-like [159638] (2 proteins) automatically mapped to Pfam PF12134 |
Protein Pre-mRNA-splicing factor 8, Prp8 [159639] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [159640] (13 PDB entries) Uniprot Q6P2Q9 1760-2016! Uniprot Q6P2Q9 1771-1989 |
Domain d4jkbb_: 4jkb B: [223861] automated match to d3enba1 complexed with cl, gol, mg |
PDB Entry: 4jkb (more details), 1.3 Å
SCOPe Domain Sequences for d4jkbb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4jkbb_ c.55.3.14 (B:) Pre-mRNA-splicing factor 8, Prp8 {Human (Homo sapiens) [TaxId: 9606]} lfsnqiiwfvddtnvyrdtihktfegnlttkpingaififnprtgqlflkiihtsvwagq krlgqlakwktaeevaalirslpveeqpkqiivtrkgmldplevhlldfpnivikgselq lpfqaclkvekfgdlilkatepqmvlfnlyddwlktissytafsrlililralhvnndra kvilkpdkttitephhiwptltdeewikvevqlkdlilad
Timeline for d4jkbb_: