| Class b: All beta proteins [48724] (180 folds) |
| Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families) ![]() |
| Family b.2.2.1: Cellulose-binding domain family II [49385] (3 proteins) automatically mapped to Pfam PF00553 |
| Protein Exo-1,4-beta-D-glycanase (cellulase, xylanase), cellulose-binding domain, CBD [49386] (1 species) belongs to subfamily IIa |
| Species Cellulomonas fimi [TaxId:1708] [49387] (2 PDB entries) |
| Domain d1exha_: 1exh A: [22386] |
PDB Entry: 1exh (more details)
SCOPe Domain Sequences for d1exha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1exha_ b.2.2.1 (A:) Exo-1,4-beta-D-glycanase (cellulase, xylanase), cellulose-binding domain, CBD {Cellulomonas fimi [TaxId: 1708]}
assgpagcqvlwgvnqwntgftanvtvkntssapvdgwtltfsfpsgqqvtqawsstvtq
sgsavtvrnapwngsipaggtaqfgfngshtgtnaaptafslngtpctvg
Timeline for d1exha_: