![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) ![]() consists of one domain of this fold |
![]() | Family c.55.3.14: Prp8 beta-finger domain-like [159638] (1 protein) automatically mapped to Pfam PF12134 |
![]() | Protein Pre-mRNA splicing factor 8, Prp8 / Spp42 [159639] (4 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [159640] (13 PDB entries) Uniprot Q6P2Q9 1760-2016! Uniprot Q6P2Q9 1771-1989 |
![]() | Domain d4jk9b_: 4jk9 B: [223857] automated match to d3enba1 complexed with cl, co, gol |
PDB Entry: 4jk9 (more details), 1.5 Å
SCOPe Domain Sequences for d4jk9b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4jk9b_ c.55.3.14 (B:) Pre-mRNA splicing factor 8, Prp8 / Spp42 {Human (Homo sapiens) [TaxId: 9606]} elfsnqiiwfvddtnvyrvtihktfegnlttkpingaififnprtgqlflkiihtsvwag qkrlgqlakwktaeevaalirslpveeqpkqiivtrkgmldplevhlldfpnivikgsel qlpfqaclkvekfgdlilkatepqmvlfnlyddwlktissytafsrlililralhvnndr akvilkpdkttitephhiwptltdeewikvevqlkdlila
Timeline for d4jk9b_: