Lineage for d4jk9b_ (4jk9 B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2885833Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) (S)
    consists of one domain of this fold
  5. 2886992Family c.55.3.14: Prp8 beta-finger domain-like [159638] (1 protein)
    automatically mapped to Pfam PF12134
  6. 2886993Protein Pre-mRNA splicing factor 8, Prp8 / Spp42 [159639] (4 species)
  7. 2887142Species Human (Homo sapiens) [TaxId:9606] [159640] (13 PDB entries)
    Uniprot Q6P2Q9 1760-2016! Uniprot Q6P2Q9 1771-1989
  8. 2887154Domain d4jk9b_: 4jk9 B: [223857]
    automated match to d3enba1
    complexed with cl, co, gol

Details for d4jk9b_

PDB Entry: 4jk9 (more details), 1.5 Å

PDB Description: Open and closed forms of wild-type human PRP8 RNase H-like domain with bound Co ion
PDB Compounds: (B:) Pre-mRNA-processing-splicing factor 8

SCOPe Domain Sequences for d4jk9b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jk9b_ c.55.3.14 (B:) Pre-mRNA splicing factor 8, Prp8 / Spp42 {Human (Homo sapiens) [TaxId: 9606]}
elfsnqiiwfvddtnvyrvtihktfegnlttkpingaififnprtgqlflkiihtsvwag
qkrlgqlakwktaeevaalirslpveeqpkqiivtrkgmldplevhlldfpnivikgsel
qlpfqaclkvekfgdlilkatepqmvlfnlyddwlktissytafsrlililralhvnndr
akvilkpdkttitephhiwptltdeewikvevqlkdlila

SCOPe Domain Coordinates for d4jk9b_:

Click to download the PDB-style file with coordinates for d4jk9b_.
(The format of our PDB-style files is described here.)

Timeline for d4jk9b_: