SCOPe 2.07: Domain d4jk8a_: 4jk8 A:

Lineage for d4jk8a_ (4jk8 A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (16 families)
   consists of one domain of this fold

5. Family c.55.3.14: Prp8 beta-finger domain-like [159638] (1 protein)
   automatically mapped to Pfam PF12134

6. Protein Pre-mRNA splicing factor 8, Prp8 / Spp42 [159639] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [159640] (13 PDB entries)
   Uniprot Q6P2Q9 1760-2016! Uniprot Q6P2Q9 1771-1989

8. Domain d4jk8a_: 4jk8 A: [223854]
   automated match to d3enba1
   complexed with cl, gol, mg

Details for d4jk8a_

PDB Entry: 4jk8, 1.15 Å

PDB Description: Open and closed forms of R1865A human PRP8 RNase H-like domain with bound Mg ion

PDB Compounds: (A:) Pre-mRNA-processing-splicing factor 8

SCOPe Domain Sequences for d4jk8a_:

Sequence; same for both SEQRES and ATOM records:

>d4jk8a_ c.55.3.14 (A:) Pre-mRNA splicing factor 8, Prp8 / Spp42 {Human (Homo sapiens) [TaxId: 9606]}
lfsnqiiwfvddtnvyrvtihktfegnlttkpingaififnprtgqlflkiihtsvwagq
krlgqlakwktaeevaalirslpveeqpkqiivtakgmldplevhlldfpnivikgselq
lpfqaclkvekfgdlilkatepqmvlfnlyddwlktissytafsrlililralhvnndra
kvilkpdkttitephhiwptltdeewikvevqlkdlilad

Timeline for d4jk8a_:

• d4jk8a_ first appeared in SCOPe 2.03
  
• d4jk8a_ appears in SCOPe 2.06