Lineage for d1xdtt1 (1xdt T:381-535)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 10320Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (7 superfamilies)
  4. 10321Superfamily b.2.1: Diphtheria toxin, C-terminal domain [49380] (1 family) (S)
  5. 10322Family b.2.1.1: Diphtheria toxin, C-terminal domain [49381] (1 protein)
  6. 10323Protein Diphtheria toxin, C-terminal domain [49382] (1 species)
  7. 10324Species Corynebacterium diphtheriae [TaxId:1717] [49383] (6 PDB entries)
  8. 10333Domain d1xdtt1: 1xdt T:381-535 [22385]
    Other proteins in same PDB: d1xdtr_, d1xdtt2, d1xdtt3

Details for d1xdtt1

PDB Entry: 1xdt (more details), 2.65 Å

PDB Description: complex of diphtheria toxin and heparin-binding epidermal growth factor

SCOP Domain Sequences for d1xdtt1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xdtt1 b.2.1.1 (T:381-535) Diphtheria toxin, C-terminal domain {Corynebacterium diphtheriae}
spghktqpflhdgyavswntvedsiirtgfqgesghdikitaentplpiagvllptipgk
ldvnkskthisvngrkirmrcraidgdvtfcrpkspvyvgngvhanlhvafhrsssekih
sneissdsigvlgyqktvdhtkvnsklslffeiks

SCOP Domain Coordinates for d1xdtt1:

Click to download the PDB-style file with coordinates for d1xdtt1.
(The format of our PDB-style files is described here.)

Timeline for d1xdtt1:

View in 3D
Domains from other chains:
(mouse over for more information)
d1xdtr_