| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) ![]() |
| Family d.108.1.0: automated matches [191308] (1 protein) not a true family |
| Protein automated matches [190038] (49 species) not a true protein |
| Species Vibrio cholerae [TaxId:666] [188612] (22 PDB entries) |
| Domain d4jjxa1: 4jjx A:1-171 [223847] Other proteins in same PDB: d4jjxa2 automated match to d3eg7b_ |
PDB Entry: 4jjx (more details), 2.83 Å
SCOPe Domain Sequences for d4jjxa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4jjxa1 d.108.1.0 (A:1-171) automated matches {Vibrio cholerae [TaxId: 666]}
mnsqltlralergdlrfihnlnnnrnimsywfeepyesfdeleelynkhihdnaerrfvv
edaqknliglvelieinyihrsaefqiiiapehqgkgfartlinraldysftilnlhkiy
lhvavenpkavhlyeecgfveeghlveeffingryqdvkrmyilqskylnr
Timeline for d4jjxa1: