SCOPe 2.08: Domain d4jj5a2: 4jj5 A:119-207

Lineage for d4jj5a2 (4jj5 A:119-207)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d4jj5a2: 4jj5 A:119-207 [223844]
   Other proteins in same PDB: d4jj5b_
   automated match to d1nj9a2

Details for d4jj5a2

PDB Entry: 4jj5, 2.44 Å

PDB Description: crystal structure of the fab fragment of 1c2, a monoclonal antibody specific for poly-glutamine

PDB Compounds: (A:) 1c2 fab light chain

SCOPe Domain Sequences for d4jj5a2:

Sequence, based on SEQRES records:

>d4jj5a2 b.1.1.0 (A:119-207) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
kstptltvfppsseelkenkatlvclisnfspsgvtvawkangtpitqgvdtsnptkegn
kfmassflhltsdqwrshnsftcqvtheg

Sequence, based on observed residues (ATOM records):

>d4jj5a2 b.1.1.0 (A:119-207) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
kstptltvfppsseelkenkatlvclisnfspsgvtvawgvdtsnptfmassflhtcqvt
heg

Timeline for d4jj5a2:

• d4jj5a2 first appeared in SCOPe 2.03
  
• d4jj5a2 appears in SCOPe 2.07