Lineage for d4jimb_ (4jim B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2111791Family c.37.1.10: Nitrogenase iron protein-like [52652] (16 protein domains)
    core: parallel beta-sheet of 7 strands; order 3241567
  6. 2112083Protein automated matches [190304] (11 species)
    not a true protein
  7. 2112103Species Moorella thermoacetica [TaxId:1525] [189834] (6 PDB entries)
  8. 2112106Domain d4jimb_: 4jim B: [223841]
    complexed with so4, toe

Details for d4jimb_

PDB Entry: 4jim (more details), 2.1 Å

PDB Description: native crystal strucutre of n10-formyltetrahydrofolate synthetase
PDB Compounds: (B:) Formate--tetrahydrofolate ligase

SCOPe Domain Sequences for d4jimb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jimb_ c.37.1.10 (B:) automated matches {Moorella thermoacetica [TaxId: 1525]}
psdieiaqaakmkpvmelarglgiqedevelygkykakisldvyrrlkdkpdgklilvta
itptpagegktttsvgltdalarlgkrvmvclrepslgpsfgikggaagggyaqvvpmed
inlhftgdihavtyahnllaamvdnhlqqgnvlnidprtitwrrvidlndralrnivigl
ggkangvpretgfdisvasevmaclclasdlmdlkerfsrivvgytydgkpvtagdleaq
gsmallmkdaikpnlvqtlentpafihggpfaniahgcnsiiatktalkladyvvteagf
gadlgaekfydvkcryagfkpdatvivatvralkmhggvpksdlatenlealregfanle
khienigkfgvpavvainafptdteaelnllyelcakagaevalsevwakggegglelar
kvlqtlesrpsnfhvlynldlsikdkiakiateiygadgvnytaeadkaiqryeslgygn
lpvvmaktqysfsddmtklgrprnftitvrevrlsagagfivpitgaimtmpglpkrpaa
cnididadgvitglf

SCOPe Domain Coordinates for d4jimb_:

Click to download the PDB-style file with coordinates for d4jimb_.
(The format of our PDB-style files is described here.)

Timeline for d4jimb_: