SCOPe 2.08: Domain d4jhxc1: 4jhx C:3-152

Lineage for d4jhxc1 (4jhx C:3-152)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.78: ATC-like [53670] (2 superfamilies)
   consists of two similar domains related by pseudo dyad; duplication
   core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families)

5. Family c.78.1.0: automated matches [227206] (1 protein)
   not a true family

6. Protein automated matches [226938] (26 species)
   not a true protein

7. Species Vibrio vulnificus [TaxId:216895] [226484] (6 PDB entries)

8. Domain d4jhxc1: 4jhx C:3-152 [223831]
   Other proteins in same PDB: d4jhxa3
   automated match to d1duvg1
   complexed with arg, cl, cp, peg

Details for d4jhxc1

PDB Entry: 4jhx, 1.85 Å

PDB Description: crystal structure of anabolic ornithine carbamoyltransferase from vibrio vulnificus in complex with carbamoylphosphate and arginine

PDB Compounds: (C:) ornithine carbamoyltransferase

SCOPe Domain Sequences for d4jhxc1:

Sequence; same for both SEQRES and ATOM records:

>d4jhxc1 c.78.1.0 (C:3-152) automated matches {Vibrio vulnificus [TaxId: 216895]}
fnlrnrnflklldfstkeiqflidlsadlkkakyagteqkkllgknialifekastrtrc
afevaafdqgaqvtyigpsgsqigdkesmkdtarvlgrmydgiqyrgfgqaiveelgafa
gvpvwngltdefhptqiladfltmlehsqg

Timeline for d4jhxc1:

• d4jhxc1 first appeared in SCOPe 2.03
  
• d4jhxc1 appears in SCOPe 2.07