Lineage for d4jhxb2 (4jhx B:153-334)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2906432Fold c.78: ATC-like [53670] (2 superfamilies)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134
  4. 2906433Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) (S)
  5. 2906884Family c.78.1.0: automated matches [227206] (1 protein)
    not a true family
  6. 2906885Protein automated matches [226938] (26 species)
    not a true protein
  7. 2907275Species Vibrio vulnificus [TaxId:216895] [226484] (6 PDB entries)
  8. 2907285Domain d4jhxb2: 4jhx B:153-334 [223830]
    Other proteins in same PDB: d4jhxa3
    automated match to d1duvg2
    complexed with arg, cl, cp, peg

Details for d4jhxb2

PDB Entry: 4jhx (more details), 1.85 Å

PDB Description: crystal structure of anabolic ornithine carbamoyltransferase from vibrio vulnificus in complex with carbamoylphosphate and arginine
PDB Compounds: (B:) ornithine carbamoyltransferase

SCOPe Domain Sequences for d4jhxb2:

Sequence, based on SEQRES records: (download)

>d4jhxb2 c.78.1.0 (B:153-334) automated matches {Vibrio vulnificus [TaxId: 216895]}
kaladiqfaylgdarnnvgnslmvgaakmgmdirlvgpqaywpdeelvaacqaiakqtgg
kitltenvaegvqgcdflytdvwvsmgespeawdervalmkpyqvnmnvlkqtgnpnvkf
mhclpafhndettigkqvadkfgmkglevteevfesehsivfdeaenrmhtikavmvatl
gs

Sequence, based on observed residues (ATOM records): (download)

>d4jhxb2 c.78.1.0 (B:153-334) automated matches {Vibrio vulnificus [TaxId: 216895]}
kaladiqfaylgdarnnvgnslmvgaakmgmdirlvgpqaywpdeelvaacqaiakqtgg
kitltenvaegvqgcdflytdvwvwdervalmkpyqvnmnvlkqtgnpnvkfmhclpafh
ndettigkqvadkfgmkglevteevfesehsivfdeaenrmhtikavmvatlgs

SCOPe Domain Coordinates for d4jhxb2:

Click to download the PDB-style file with coordinates for d4jhxb2.
(The format of our PDB-style files is described here.)

Timeline for d4jhxb2: