![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.78: ATC-like [53670] (2 superfamilies) consists of two similar domains related by pseudo dyad; duplication core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134 |
![]() | Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) ![]() |
![]() | Family c.78.1.0: automated matches [227206] (1 protein) not a true family |
![]() | Protein automated matches [226938] (26 species) not a true protein |
![]() | Species Vibrio vulnificus [TaxId:216895] [226484] (6 PDB entries) |
![]() | Domain d4jhxb2: 4jhx B:153-334 [223830] Other proteins in same PDB: d4jhxa3 automated match to d1duvg2 complexed with arg, cl, cp, peg |
PDB Entry: 4jhx (more details), 1.85 Å
SCOPe Domain Sequences for d4jhxb2:
Sequence, based on SEQRES records: (download)
>d4jhxb2 c.78.1.0 (B:153-334) automated matches {Vibrio vulnificus [TaxId: 216895]} kaladiqfaylgdarnnvgnslmvgaakmgmdirlvgpqaywpdeelvaacqaiakqtgg kitltenvaegvqgcdflytdvwvsmgespeawdervalmkpyqvnmnvlkqtgnpnvkf mhclpafhndettigkqvadkfgmkglevteevfesehsivfdeaenrmhtikavmvatl gs
>d4jhxb2 c.78.1.0 (B:153-334) automated matches {Vibrio vulnificus [TaxId: 216895]} kaladiqfaylgdarnnvgnslmvgaakmgmdirlvgpqaywpdeelvaacqaiakqtgg kitltenvaegvqgcdflytdvwvwdervalmkpyqvnmnvlkqtgnpnvkfmhclpafh ndettigkqvadkfgmkglevteevfesehsivfdeaenrmhtikavmvatlgs
Timeline for d4jhxb2: