| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.78: ATC-like [53670] (2 superfamilies) consists of two similar domains related by pseudo dyad; duplication core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) ![]() |
| Family c.78.1.0: automated matches [227206] (1 protein) not a true family |
| Protein automated matches [226938] (26 species) not a true protein |
| Species Vibrio vulnificus [TaxId:216895] [226484] (6 PDB entries) |
| Domain d4jhxa2: 4jhx A:153-334 [223828] Other proteins in same PDB: d4jhxa3 automated match to d1duvg2 complexed with arg, cl, cp, peg |
PDB Entry: 4jhx (more details), 1.85 Å
SCOPe Domain Sequences for d4jhxa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4jhxa2 c.78.1.0 (A:153-334) automated matches {Vibrio vulnificus [TaxId: 216895]}
kaladiqfaylgdarnnvgnslmvgaakmgmdirlvgpqaywpdeelvaacqaiakqtgg
kitltenvaegvqgcdflytdvwvsmgespeawdervalmkpyqvnmnvlkqtgnpnvkf
mhclpafhndettigkqvadkfgmkglevteevfesehsivfdeaenrmhtikavmvatl
gs
Timeline for d4jhxa2:
View in 3DDomains from other chains: (mouse over for more information) d4jhxb1, d4jhxb2, d4jhxc1, d4jhxc2 |