SCOPe 2.05: Domain d4jhxa1: 4jhx A:-1-152

Lineage for d4jhxa1 (4jhx A:-1-152)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.78: ATC-like [53670] (2 superfamilies)
   consists of two similar domains related by pseudo dyad; duplication
   core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families)

5. Family c.78.1.0: automated matches [227206] (1 protein)
   not a true family

6. Protein automated matches [226938] (22 species)
   not a true protein

7. Species Vibrio vulnificus [TaxId:216895] [226484] (6 PDB entries)

8. Domain d4jhxa1: 4jhx A:-1-152 [223827]
   automated match to d1duvg1
   complexed with arg, cl, cp, peg

Details for d4jhxa1

PDB Entry: 4jhx, 1.85 Å

PDB Description: crystal structure of anabolic ornithine carbamoyltransferase from vibrio vulnificus in complex with carbamoylphosphate and arginine

PDB Compounds: (A:) ornithine carbamoyltransferase

SCOPe Domain Sequences for d4jhxa1:

Sequence; same for both SEQRES and ATOM records:

>d4jhxa1 c.78.1.0 (A:-1-152) automated matches {Vibrio vulnificus [TaxId: 216895]}
namafnlrnrnflklldfstkeiqflidlsadlkkakyagteqkkllgknialifekast
rtrcafevaafdqgaqvtyigpsgsqigdkesmkdtarvlgrmydgiqyrgfgqaiveel
gafagvpvwngltdefhptqiladfltmlehsqg

Timeline for d4jhxa1:

• d4jhxa1 first appeared in SCOPe 2.03
  
• d4jhxa1 appears in SCOPe 2.04
  
• d4jhxa1 appears in SCOPe 2.06
  
• d4jhxa1 appears in the current release, SCOPe 2.08