Lineage for d4jhta_ (4jht A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1330392Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 1331086Superfamily b.82.2: Clavaminate synthase-like [51197] (14 families) (S)
    Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold
  5. 1331315Family b.82.2.10: AlkB-like [141628] (3 proteins)
    automatically mapped to Pfam PF13532
  6. 1331331Protein automated matches [191077] (2 species)
    not a true protein
  7. 1331350Species Escherichia coli [TaxId:83333] [195877] (4 PDB entries)
  8. 1331351Domain d4jhta_: 4jht A: [223826]
    automated match to d3t4hb_
    complexed with 8xq, dms, mn

Details for d4jhta_

PDB Entry: 4jht (more details), 1.18 Å

PDB Description: crystal structure of alkb in complex with 5-carboxy-8-hydroxyquinoline (iox1)
PDB Compounds: (A:) Alpha-ketoglutarate-dependent dioxygenase AlkB

SCOPe Domain Sequences for d4jhta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jhta_ b.82.2.10 (A:) automated matches {Escherichia coli [TaxId: 83333]}
plaagavilrrfafnaaeqlirdindvasqspfrqmvtpggytmsvamtncghlgwtthr
qgylyspidpqtnkpwpampqsfhnlcqraataagypdfqpdaclinryapgaklslhqd
kdepdlrapivsvslglpaifqfgglkrndplkrlllehgdvvvwggesrlfyhgiqplk
agfhpltidcrynltfrqagk

SCOPe Domain Coordinates for d4jhta_:

Click to download the PDB-style file with coordinates for d4jhta_.
(The format of our PDB-style files is described here.)

Timeline for d4jhta_: