SCOPe 2.03: Domain d4jgtb2: 4jgt B:152-288

Lineage for d4jgtb2 (4jgt B:152-288)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.46: Rhodanese/Cell cycle control phosphatase [52820] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32451

4. Superfamily c.46.1: Rhodanese/Cell cycle control phosphatase [52821] (5 families)
   Pfam PF00581
   the active site structure is similar to those of the families I and II protein phosphatases; the topology can be related by a different circular permutation to the family I topology

5. Family c.46.1.0: automated matches [227256] (1 protein)
   not a true family

6. Protein automated matches [227041] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225989] (2 PDB entries)

8. Domain d4jgtb2: 4jgt B:152-288 [223813]
   automated match to d1rhda2
   complexed with gol, pyr, so4

Details for d4jgtb2

PDB Entry: 4jgt, 2.16 Å

PDB Description: Structure and kinetic analysis of H2S production by human Mercaptopyruvate Sulfurtransferase

PDB Compounds: (B:) 3-mercaptopyruvate sulfurtransferase

SCOPe Domain Sequences for d4jgtb2:

Sequence; same for both SEQRES and ATOM records:

>d4jgtb2 c.46.1.0 (B:152-288) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aefraqldpafiktyedikenlesrrfqvvdsratgrfrgtepeprdgiepghipgtvni
pftdflsqeglekspeeirhlfqekkvdlskplvatcgsgvtachvalgaylcgkpdvpi
ydgswvewymrarpedv

Timeline for d4jgtb2:

• d4jgtb2 is new in SCOPe 2.03-stable
  
• d4jgtb2 appears in SCOPe 2.04
  
• d4jgtb2 appears in the current release, SCOPe 2.08