Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.46: Rhodanese/Cell cycle control phosphatase [52820] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32451 |
Superfamily c.46.1: Rhodanese/Cell cycle control phosphatase [52821] (5 families) Pfam PF00581 the active site structure is similar to those of the families I and II protein phosphatases; the topology can be related by a different circular permutation to the family I topology |
Family c.46.1.0: automated matches [227256] (1 protein) not a true family |
Protein automated matches [227041] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225989] (3 PDB entries) |
Domain d4jgta1: 4jgt A:11-151 [223810] Other proteins in same PDB: d4jgta3, d4jgtb3, d4jgtc3 automated match to d1rhda1 complexed with gol, pyr, so4 |
PDB Entry: 4jgt (more details), 2.16 Å
SCOPe Domain Sequences for d4jgta1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4jgta1 c.46.1.0 (A:11-151) automated matches {Human (Homo sapiens) [TaxId: 9606]} vsaqwvaealrapragqplqlldaswylpklgrdarrefeerhipgaaffdidqcsdrts pydhmlpgaehfaeyagrlgvgaathvviydasdqglysaprvwwmfrafghhavslldg glrhwlrqnlplssgksqpap
Timeline for d4jgta1: