SCOPe 2.05: Domain d1mdta1: 1mdt A:381-535

Lineage for d1mdta1 (1mdt A:381-535)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.1: Diphtheria toxin, C-terminal domain [49380] (2 families)
   automatically mapped to Pfam PF01324

5. Family b.2.1.1: Diphtheria toxin, C-terminal domain [49381] (1 protein)

6. Protein Diphtheria toxin, C-terminal domain [49382] (1 species)

7. Species Corynebacterium diphtheriae [TaxId:1717] [49383] (7 PDB entries)

8. Domain d1mdta1: 1mdt A:381-535 [22381]
   Other proteins in same PDB: d1mdta2, d1mdta3, d1mdtb2, d1mdtb3
   complexed with apu

Details for d1mdta1

PDB Entry: 1mdt, 2.3 Å

PDB Description: the refined structure of monomeric diphtheria toxin at 2.3 angstroms resolution

PDB Compounds: (A:) diphtheria toxin

SCOPe Domain Sequences for d1mdta1:

Sequence; same for both SEQRES and ATOM records:

>d1mdta1 b.2.1.1 (A:381-535) Diphtheria toxin, C-terminal domain {Corynebacterium diphtheriae [TaxId: 1717]}
spghktqpflhdgyavswntvedsiirtgfqgesghdikitaentplpiagvllptipgk
ldvnkskthisvngrkirmrcraidgdvtfcrpkspvyvgngvhanlhvafhrsssekih
sneissdsigvlgyqktvdhtkvnsklslffeiks

Timeline for d1mdta1:

• d1mdta1 first appeared (with stable ids) in SCOP 1.55
  
• d1mdta1 appears in SCOPe 2.04
  
• d1mdta1 appears in SCOPe 2.06
  
• d1mdta1 appears in the current release, SCOPe 2.08